> >>>Human RPS6KA5 partial ORF ( AAH17187.1, 372 a.a. - 470 a.a.) recombinant protein with GST-tag at N-terminal.
Nuevo RPS6KA5 (Human) Recombinant Protein (Q02) Ver mas grande

Human RPS6KA5 partial ORF ( AAH17187.1, 372 a.a. - 470 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00009252-Q02

Producto nuevo

RPS6KA5 (Human) Recombinant Protein (Q02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name RPS6KA5
Gene Alias MGC1911|MSK1|MSPK1|RLPK
Gene Description ribosomal protein S6 kinase, 90kDa, polypeptide 5
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq FQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFYQHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEIT
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 9252

Más información

Human RPS6KA5 partial ORF ( AAH17187.1, 372 a.a. - 470 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human RPS6KA5 partial ORF ( AAH17187.1, 372 a.a. - 470 a.a.) recombinant protein with GST-tag at N-terminal.

Human RPS6KA5 partial ORF ( AAH17187.1, 372 a.a. - 470 a.a.) recombinant protein with GST-tag at N-terminal.