Ver mas grande
Human HIST1H3F full-length ORF (ADR82713.1, 1 a.a. - 136 a.a.) recombinant protein with GST tag at N-terminal.
AB-H00008968-P01
Producto nuevo
HIST1H3F (Human) Recombinant Protein (P01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | HIST1H3F |
| Gene Alias | H3/i|H3FI |
| Gene Description | histone cluster 1, H3f |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 8968 |
Más información
Human HIST1H3F full-length ORF (ADR82713.1, 1 a.a. - 136 a.a.) recombinant protein with GST tag at N-terminal.