Ver mas grande
Human G10 full-length ORF ( AAH22821, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00008896-P01
Producto nuevo
G10 (Human) Recombinant Protein (P01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | BUD31 |
| Gene Alias | EDG-2|EDG2|G10|MGC111202|YCR063W|fSAP17 |
| Gene Description | BUD31 homolog (S. cerevisiae) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 8896 |
Más información
Human G10 full-length ORF ( AAH22821, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.