> >>>Human CDK5R1 partial ORF ( AAH20580, 208 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.
CDK5R1 (Human) Recombinant Protein (Q01) Ver mas grande

Human CDK5R1 partial ORF ( AAH20580, 208 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00008851-Q01

Producto nuevo

CDK5R1 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name CDK5R1
Gene Alias CDK5P35|CDK5R|MGC33831|NCK5A|p23|p25|p35|p35nck5a
Gene Description cyclin-dependent kinase 5, regulatory subunit 1 (p35)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq CRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 8851

Más información

Human CDK5R1 partial ORF ( AAH20580, 208 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human CDK5R1 partial ORF ( AAH20580, 208 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.

Human CDK5R1 partial ORF ( AAH20580, 208 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.