PCAF (Human) Recombinant Protein (Q02) Ver mas grande

Human PCAF partial ORF ( NP_003875, 731 a.a. - 832 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00008850-Q02

Producto nuevo

PCAF (Human) Recombinant Protein (Q02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name KAT2B
Gene Alias CAF|P|P/CAF|PCAF
Gene Description K(lysine) acetyltransferase 2B
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq TLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 8850

Más información

Human PCAF partial ORF ( NP_003875, 731 a.a. - 832 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human PCAF partial ORF ( NP_003875, 731 a.a. - 832 a.a.) recombinant protein with GST-tag at N-terminal.

Human PCAF partial ORF ( NP_003875, 731 a.a. - 832 a.a.) recombinant protein with GST-tag at N-terminal.