Nuevo NRP1 (Human) Recombinant Protein (Q01) Ver mas grande

Human NRP1 partial ORF (NP_003864.4, 22 a.a. - 131 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00008829-Q01

Producto nuevo

NRP1 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name NRP1
Gene Alias BDCA4|CD304|DKFZp686A03134|DKFZp781F1414|NP1|NRP|VEGF165R
Gene Description neuropilin 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHG
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 8829

Más información

Human NRP1 partial ORF (NP_003864.4, 22 a.a. - 131 a.a.) recombinant protein with GST tag at N-terminal.

Consulta sobre un producto

Human NRP1 partial ORF (NP_003864.4, 22 a.a. - 131 a.a.) recombinant protein with GST tag at N-terminal.

Human NRP1 partial ORF (NP_003864.4, 22 a.a. - 131 a.a.) recombinant protein with GST tag at N-terminal.