> >>>Human DLK1 full-length ORF ( AAH07741.1, 25 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.
DLK1 (Human) Recombinant Protein (P01) Ver mas grande

Human DLK1 full-length ORF ( AAH07741.1, 25 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00008788-P01

Producto nuevo

DLK1 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name DLK1
Gene Alias DLK|FA1|PREF1|Pref-1|ZOG|pG2
Gene Description delta-like 1 homolog (Drosophila)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq ECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSRAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQ
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 8788

Más información

Human DLK1 full-length ORF ( AAH07741.1, 25 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human DLK1 full-length ORF ( AAH07741.1, 25 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.

Human DLK1 full-length ORF ( AAH07741.1, 25 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.