Ver mas grande
Human ANXA9 partial ORF ( NP_003559.1, 270 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00008416-Q01
Producto nuevo
ANXA9 (Human) Recombinant Protein (Q01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | ANXA9 |
| Gene Alias | ANX31 |
| Gene Description | annexin A9 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | DKLHQALQETEPNYQVLIRILISRCETDLLSIRAEFRKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 8416 |
Más información
Human ANXA9 partial ORF ( NP_003559.1, 270 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal.