> >>>Human ARID1A partial ORF ( NP_006006, 1216 a.a. - 1325 a.a.) recombinant protein with GST-tag at N-terminal.
Nuevo ARID1A (Human) Recombinant Protein (Q01) Ver mas grande

Human ARID1A partial ORF ( NP_006006, 1216 a.a. - 1325 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00008289-Q01

Producto nuevo

ARID1A (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name ARID1A
Gene Alias B120|BAF250|BAF250a|BM029|C1orf4|P270|SMARCF1
Gene Description AT rich interactive domain 1A (SWI-like)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYP
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 8289

Más información

Human ARID1A partial ORF ( NP_006006, 1216 a.a. - 1325 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human ARID1A partial ORF ( NP_006006, 1216 a.a. - 1325 a.a.) recombinant protein with GST-tag at N-terminal.

Human ARID1A partial ORF ( NP_006006, 1216 a.a. - 1325 a.a.) recombinant protein with GST-tag at N-terminal.