> >>>Human TPR partial ORF ( NP_003283, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
Nuevo TPR (Human) Recombinant Protein (Q01) Ver mas grande

Human TPR partial ORF ( NP_003283, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00007175-Q01

Producto nuevo

TPR (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name TPR
Gene Alias -
Gene Description translocated promoter region (to activated MET oncogene)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKE
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 7175

Más información

Human TPR partial ORF ( NP_003283, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human TPR partial ORF ( NP_003283, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.

Human TPR partial ORF ( NP_003283, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.