Ver mas grande
Human TLR5 partial ORF (NP_003259.2, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00007100-Q03
Producto nuevo
TLR5 (Human) Recombinant Protein (Q03)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | TLR5 |
| Gene Alias | FLJ10052|MGC126430|MGC126431|SLEB1|TIL3 |
| Gene Description | toll-like receptor 5 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | LYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILYFLLRVPHL |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 7100 |
Más información
Human TLR5 partial ORF (NP_003259.2, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.