> >>>Human SLC1A3 partial ORF ( NP_004163.2, 162 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.
SLC1A3 (Human) Recombinant Protein (Q01) Ver mas grande

Human SLC1A3 partial ORF ( NP_004163.2, 162 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00006507-Q01

Producto nuevo

SLC1A3 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name SLC1A3
Gene Alias EA6|EAAT1|FLJ25094|GLAST|GLAST1
Gene Description solute carrier family 1 (glial high affinity glutamate transporter), member 3
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 6507

Más información

Human SLC1A3 partial ORF ( NP_004163.2, 162 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human SLC1A3 partial ORF ( NP_004163.2, 162 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.

Human SLC1A3 partial ORF ( NP_004163.2, 162 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.