> >>>Human SEC13 full-length ORF ( NP_899195.1, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal.
Nuevo SEC13 (Human) Recombinant Protein (P02) Ver mas grande

Human SEC13 full-length ORF ( NP_899195.1, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00006396-P02

Producto nuevo

SEC13 (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name SEC13
Gene Alias D3S1231E|SEC13L1|SEC13R|npp-20
Gene Description SEC13 homolog (S. cerevisiae)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSP
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 6396

Más información

Human SEC13 full-length ORF ( NP_899195.1, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human SEC13 full-length ORF ( NP_899195.1, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal.

Human SEC13 full-length ORF ( NP_899195.1, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal.