> >>>Human S100A12 full-length ORF ( NP_005612.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
S100A12 (Human) Recombinant Protein (P02) Ver mas grande

Human S100A12 full-length ORF ( NP_005612.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00006283-P02

Producto nuevo

S100A12 (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name S100A12
Gene Alias CAAF1|CAGC|CGRP|ENRAGE|MRP6|p6
Gene Description S100 calcium binding protein A12
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 6283

Más información

Human S100A12 full-length ORF ( NP_005612.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human S100A12 full-length ORF ( NP_005612.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.

Human S100A12 full-length ORF ( NP_005612.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.