RASGRF1 (Human) Recombinant Protein (Q01) Ver mas grande

Human RASGRF1 partial ORF ( NP_002882, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00005923-Q01

Producto nuevo

RASGRF1 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name RASGRF1
Gene Alias CDC25|CDC25L|GNRP|GRF1|GRF55|H-GRF55|PP13187
Gene Description Ras protein-specific guanine nucleotide-releasing factor 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELR
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 5923

Más información

Human RASGRF1 partial ORF ( NP_002882, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human RASGRF1 partial ORF ( NP_002882, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Human RASGRF1 partial ORF ( NP_002882, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.