Ver mas grande
Human PYY full-length ORF ( AAH41057.1, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00005697-P01
Producto nuevo
PYY (Human) Recombinant Protein (P01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | PYY |
| Gene Alias | PYY1 |
| Gene Description | peptide YY |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 5697 |
Más información
Human PYY full-length ORF ( AAH41057.1, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.