> >>>Human PRKG1 partial ORF ( NP_006249, 73 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
PRKG1 (Human) Recombinant Protein (Q01) Ver mas grande

Human PRKG1 partial ORF ( NP_006249, 73 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00005592-Q01

Producto nuevo

PRKG1 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name PRKG1
Gene Alias CGKI|DKFZp686K042|FLJ36117|MGC71944|PGK|PKG|PRKG1B|PRKGR1B|cGKI-BETA|cGKI-alpha
Gene Description protein kinase, cGMP-dependent, type I
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGV
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 5592

Más información

Human PRKG1 partial ORF ( NP_006249, 73 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human PRKG1 partial ORF ( NP_006249, 73 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Human PRKG1 partial ORF ( NP_006249, 73 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.