Ver mas grande
Human MUC4 partial ORF ( NP_004523, 79 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00004585-Q01
Producto nuevo
MUC4 (Human) Recombinant Protein (Q01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | MUC4 |
| Gene Alias | HSA276359 |
| Gene Description | mucin 4, cell surface associated |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | GVSLFPYGADAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNGQIIFPESDYQIFSYPNPLPTGFTGRDPVALVAPFWDDADFSTGRGTTFYQEYETFYGEHS |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 4585 |
Más información
Human MUC4 partial ORF ( NP_004523, 79 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.