> >>>Human MPZ full-length ORF ( AAH06491.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.
Nuevo MPZ (Human) Recombinant Protein (P01) Ver mas grande

Human MPZ full-length ORF ( AAH06491.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00004359-P01

Producto nuevo

MPZ (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name MPZ
Gene Alias CHM|CMT1|CMT1B|CMT2I|CMT2J|CMT4E|CMTDI3|DSS|HMSNIB|MPP|P0
Gene Description myelin protein zero
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 4359

Más información

Human MPZ full-length ORF ( AAH06491.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human MPZ full-length ORF ( AAH06491.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.

Human MPZ full-length ORF ( AAH06491.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.