> >>>Human ALDH6A1 full-length ORF ( AAH32371, 10 a.a. - 535 a.a.) recombinant protein with GST-tag at N-terminal.
ALDH6A1 (Human) Recombinant Protein (P01) Ver mas grande

Human ALDH6A1 full-length ORF ( AAH32371, 10 a.a. - 535 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00004329-P01

Producto nuevo

ALDH6A1 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name ALDH6A1
Gene Alias MGC40271|MMSADHA|MMSDH
Gene Description aldehyde dehydrogenase 6 family, member A1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq VRARILQVSSKVKSSPTWYSASSFSSSVPTVKLFIGGKFVESKSDKWIDIHNPATNEVIGRVPQATKAEMDAAIASCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSITKDMDLYSYRLPLGVCAGIAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISFVGSNK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 4329

Más información

Human ALDH6A1 full-length ORF ( AAH32371, 10 a.a. - 535 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human ALDH6A1 full-length ORF ( AAH32371, 10 a.a. - 535 a.a.) recombinant protein with GST-tag at N-terminal.

Human ALDH6A1 full-length ORF ( AAH32371, 10 a.a. - 535 a.a.) recombinant protein with GST-tag at N-terminal.