> >>>Human MARCKS partial ORF ( NP_002347, 2 a.a. - 65 a.a.) recombinant protein with GST-tag at N-terminal.
MARCKS (Human) Recombinant Protein (Q01) Ver mas grande

Human MARCKS partial ORF ( NP_002347, 2 a.a. - 65 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00004082-Q01

Producto nuevo

MARCKS (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name MARCKS
Gene Alias 80K-L|FLJ14368|FLJ90045|MACS|PKCSL|PRKCSL
Gene Description myristoylated alanine-rich protein kinase C substrate
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 4082

Más información

Human MARCKS partial ORF ( NP_002347, 2 a.a. - 65 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human MARCKS partial ORF ( NP_002347, 2 a.a. - 65 a.a.) recombinant protein with GST-tag at N-terminal.

Human MARCKS partial ORF ( NP_002347, 2 a.a. - 65 a.a.) recombinant protein with GST-tag at N-terminal.