Nuevo KRAS (Human) Recombinant Protein (P02) Ver mas grande

Human KRAS full-length ORF (NP_203524.1, 1 a.a. - 189 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00003845-P02

Producto nuevo

KRAS (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name KRAS
Gene Alias C-K-RAS|K-RAS2A|K-RAS2B|K-RAS4A|K-RAS4B|KI-RAS|KRAS1|KRAS2|NS3|RASK2
Gene Description v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3845

Más información

Human KRAS full-length ORF (NP_203524.1, 1 a.a. - 189 a.a.) recombinant protein with GST tag at N-terminal.

Consulta sobre un producto

Human KRAS full-length ORF (NP_203524.1, 1 a.a. - 189 a.a.) recombinant protein with GST tag at N-terminal.

Human KRAS full-length ORF (NP_203524.1, 1 a.a. - 189 a.a.) recombinant protein with GST tag at N-terminal.