> >>>Human KCNN3 full-length ORF ( NP_740752.1, 1 a.a. - 426 a.a.) recombinant protein with GST-tag at N-terminal.
KCNN3 (Human) Recombinant Protein (P02) Ver mas grande

Human KCNN3 full-length ORF ( NP_740752.1, 1 a.a. - 426 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00003782-P02

Producto nuevo

KCNN3 (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name KCNN3
Gene Alias KCa2.3|SK3|SKCA3|hSK3
Gene Description potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MERPIKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMM
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3782

Más información

Human KCNN3 full-length ORF ( NP_740752.1, 1 a.a. - 426 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human KCNN3 full-length ORF ( NP_740752.1, 1 a.a. - 426 a.a.) recombinant protein with GST-tag at N-terminal.

Human KCNN3 full-length ORF ( NP_740752.1, 1 a.a. - 426 a.a.) recombinant protein with GST-tag at N-terminal.