> >>>Human IL1B full-length ORF ( AAH08678.1, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.
IL1B (Human) Recombinant Protein (P02) Ver mas grande

Human IL1B full-length ORF ( AAH08678.1, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00003553-P02

Producto nuevo

IL1B (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name IL1B
Gene Alias IL-1|IL1-BETA|IL1F2
Gene Description interleukin 1, beta
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKG
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3553

Más información

Human IL1B full-length ORF ( AAH08678.1, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human IL1B full-length ORF ( AAH08678.1, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.

Human IL1B full-length ORF ( AAH08678.1, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.