> >>>Human NR4A1 full-length ORF ( NP_002126.2, 1 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal.
NR4A1 (Human) Recombinant Protein (P02) Ver mas grande

Human NR4A1 full-length ORF ( NP_002126.2, 1 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00003164-P02

Producto nuevo

NR4A1 (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name NR4A1
Gene Alias GFRP1|HMR|MGC9485|N10|NAK-1|NGFIB|NP10|NUR77|TR3
Gene Description nuclear receptor subfamily 4, group A, member 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKA
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3164

Más información

Human NR4A1 full-length ORF ( NP_002126.2, 1 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human NR4A1 full-length ORF ( NP_002126.2, 1 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal.

Human NR4A1 full-length ORF ( NP_002126.2, 1 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal.