> >>>Human FPR3 partial ORF (NP_002021.3, 254 a.a. - 353 a.a.) recombinant protein with GST tag at N-terminal.
FPR3 (Human) Recombinant Protein (Q01) Ver mas grande

Human FPR3 partial ORF (NP_002021.3, 254 a.a. - 353 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00002359-Q01

Producto nuevo

FPR3 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name FPR3
Gene Alias FML2_HUMAN|FMLPY|FPRH1|FPRH2|FPRL2|RMLP-R-I
Gene Description formyl peptide receptor 3
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq WFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPILYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 2359

Más información

Human FPR3 partial ORF (NP_002021.3, 254 a.a. - 353 a.a.) recombinant protein with GST tag at N-terminal.

Consulta sobre un producto

Human FPR3 partial ORF (NP_002021.3, 254 a.a. - 353 a.a.) recombinant protein with GST tag at N-terminal.

Human FPR3 partial ORF (NP_002021.3, 254 a.a. - 353 a.a.) recombinant protein with GST tag at N-terminal.