> >>>Human PTK2B partial ORF ( AAH36651, 682 a.a. - 871 a.a.) recombinant protein with GST-tag at N-terminal.
PTK2B (Human) Recombinant Protein (Q01) Ver mas grande

Human PTK2B partial ORF ( AAH36651, 682 a.a. - 871 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00002185-Q01

Producto nuevo

PTK2B (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name PTK2B
Gene Alias CADTK|CAKB|FADK2|FAK2|FRNK|PKB|PTK|PYK2|RAFTK
Gene Description PTK2B protein tyrosine kinase 2 beta
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq VYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTA
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 2185

Más información

Human PTK2B partial ORF ( AAH36651, 682 a.a. - 871 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human PTK2B partial ORF ( AAH36651, 682 a.a. - 871 a.a.) recombinant protein with GST-tag at N-terminal.

Human PTK2B partial ORF ( AAH36651, 682 a.a. - 871 a.a.) recombinant protein with GST-tag at N-terminal.