> >>>Human ECHS1 full-length ORF ( AAH08906, 13 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.
ECHS1 (Human) Recombinant Protein (P02) Ver mas grande

Human ECHS1 full-length ORF ( AAH08906, 13 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00001892-P02

Producto nuevo

ECHS1 (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name ECHS1
Gene Alias SCEH
Gene Description enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq GPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTF
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1892

Más información

Human ECHS1 full-length ORF ( AAH08906, 13 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human ECHS1 full-length ORF ( AAH08906, 13 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.

Human ECHS1 full-length ORF ( AAH08906, 13 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.