> >>>Human CHD4 partial ORF ( NP_001264, 1632 a.a. - 1730 a.a.) recombinant protein with GST-tag at N-terminal.
Nuevo CHD4 (Human) Recombinant Protein (Q01) Ver mas grande

Human CHD4 partial ORF ( NP_001264, 1632 a.a. - 1730 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00001108-Q01

Producto nuevo

CHD4 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name CHD4
Gene Alias DKFZp686E06161|Mi-2b|Mi2-BETA
Gene Description chromodomain helicase DNA binding protein 4
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1108

Más información

Human CHD4 partial ORF ( NP_001264, 1632 a.a. - 1730 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human CHD4 partial ORF ( NP_001264, 1632 a.a. - 1730 a.a.) recombinant protein with GST-tag at N-terminal.

Human CHD4 partial ORF ( NP_001264, 1632 a.a. - 1730 a.a.) recombinant protein with GST-tag at N-terminal.