Ver mas grande
Human CDKN2B full-length ORF ( AAH14469, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00001030-P01
Producto nuevo
CDKN2B (Human) Recombinant Protein (P01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | CDKN2B |
| Gene Alias | CDK4I|INK4B|MTS2|P15|TP15|p15INK4b |
| Gene Description | cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 1030 |
Más información
Human CDKN2B full-length ORF ( AAH14469, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.