> >>>Human CD6 partial ORF ( NP_006716, 308 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
CD6 (Human) Recombinant Protein (Q01) Ver mas grande

Human CD6 partial ORF ( NP_006716, 308 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00000923-Q01

Producto nuevo

CD6 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name CD6
Gene Alias FLJ44171|TP120
Gene Description CD6 molecule
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq CGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 923

Más información

Human CD6 partial ORF ( NP_006716, 308 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human CD6 partial ORF ( NP_006716, 308 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

Human CD6 partial ORF ( NP_006716, 308 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.