Ver mas grande
Human ARSA partial ORF ( AAH14210, 398 a.a. - 507 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00000410-Q01
Producto nuevo
ARSA (Human) Recombinant Protein (Q01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | ARSA |
| Gene Alias | MLD |
| Gene Description | arylsulfatase A |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | FFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVQQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPHA |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 410 |
Más información
Human ARSA partial ORF ( AAH14210, 398 a.a. - 507 a.a.) recombinant protein with GST-tag at N-terminal.