> >>>Human ARRB2 partial ORF ( AAH07427, 300 a.a. - 409 a.a.) recombinant protein with GST-tag at N-terminal.
ARRB2 (Human) Recombinant Protein (Q01) Ver mas grande

Human ARRB2 partial ORF ( AAH07427, 300 a.a. - 409 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00000409-Q01

Producto nuevo

ARRB2 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name ARRB2
Gene Alias ARB2|ARR2|BARR2|DKFZp686L0365
Gene Description arrestin, beta 2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 409

Más información

Human ARRB2 partial ORF ( AAH07427, 300 a.a. - 409 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human ARRB2 partial ORF ( AAH07427, 300 a.a. - 409 a.a.) recombinant protein with GST-tag at N-terminal.

Human ARRB2 partial ORF ( AAH07427, 300 a.a. - 409 a.a.) recombinant protein with GST-tag at N-terminal.