Nuevo AMY1B (Human) Recombinant Protein (P02) Ver mas grande

Human AMY1B full-length ORF (NP_001008219.1, 16 a.a. - 511 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00000277-P02

Producto nuevo

AMY1B (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name AMY1B
Gene Alias AMY1
Gene Description amylase, alpha 1B (salivary)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTE
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 277

Más información

Human AMY1B full-length ORF (NP_001008219.1, 16 a.a. - 511 a.a.) recombinant protein with GST tag at N-terminal.

Consulta sobre un producto

Human AMY1B full-length ORF (NP_001008219.1, 16 a.a. - 511 a.a.) recombinant protein with GST tag at N-terminal.

Human AMY1B full-length ORF (NP_001008219.1, 16 a.a. - 511 a.a.) recombinant protein with GST tag at N-terminal.