Ver mas grande
Human FGL2 (Q14314, 205 a.a. - 439 a.a.) partial recombinant protein with His-Avi tag and Flag tag at N-terminus expressed in HE
AB-P9735
Producto nuevo
FGL2 (Human) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | FGL2 |
| Gene Alias | T49|pT49 |
| Gene Description | fibrinogen-like 2 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | VQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SEC-HPLC and Tris-Bis PAGE |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 10875 |
Más información
Human FGL2 (Q14314, 205 a.a. - 439 a.a.) partial recombinant protein with His-Avi tag and Flag tag at N-terminus expressed in HEK293 cells.