AB-P9705
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Size | 100 ug |
Gene Name | CLEC4C |
Gene Alias | BDCA2|CD303|CLECSF11|CLECSF7|DLEC|HECL|MGC125789|MGC125791|MGC125792|MGC125793|PRO34150 |
Gene Description | C-type lectin domain family 4, member C |
Storage Conditions | Store at -80ºC for 12 Month.<br>Aliquot to avoid repeated freezing and thawing. |
Immunogen Prot. Seq | FMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
Form | Liquid |
Recomended Dilution | Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | SEC-HPLC and Tris-Bis PAGE |
Storage Buffer | In 20 mM Tris, 300 mM NaCl, 200 mM L-Arginine PH (pH 8.5) |
Gene ID | 170482 |