Ver mas grande
CD47 (Human) Recombinant Protein
AB-P9666
Producto nuevo
CD47 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | CD47 |
| Gene Alias | IAP|MER6|OA3 |
| Gene Description | CD47 molecule |
| Storage Conditions | Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNELEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP_x005F_x000D__x000D_EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 961 |
Más información
Human CD47 (Q08722, 19 a.a. - 141 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.