Ver mas grande
Human CD3G (P09693, 23 a.a. - 116 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
AB-P9640
Producto nuevo
CD3G (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 5 ug |
| Gene Name | CD3G |
| Gene Alias | CD3-GAMMA|FLJ17620|FLJ17664|FLJ79544|FLJ94613|MGC138597|T3G |
| Gene Description | CD3g molecule, gamma (CD3-TCR complex) |
| Storage Conditions | Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ADPQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISHHHHHH |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 917 |
Más información
Human CD3G (P09693, 23 a.a. - 116 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.