Ver mas grande
CCL17 (Rhesus Macaque) Recombinant Protein
AB-P9586
Producto nuevo
CCL17 (Rhesus Macaque) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | CCL17 |
| Gene Alias | - |
| Gene Description | chemokine (C-C motif) ligand 17 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ARGTNVGRECCLKYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQNKAICSDPNDKKVKKALKYLQSLERS |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is 0.5 mg/mL |
| Gene ID | 574180 |
Más información
Rhesus Macaque CCL17 (Q8HYP9, 24 a.a. - 94 a.a.) partial recombinant protein expressed in Escherichia coli.