Ver mas grande
Mouse Cxcl12 (P40224, 22 a.a. - 89 a.a.) partial recombinant protein expressed in iEscherichia coli/i.
AB-P9571
Producto nuevo
Cxcl12 (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Cxcl12 |
| Gene Alias | AI174028|PBSF|PBSF/SDF-1|SDF-1|Scyb12|Sdf1|Sdf1a|Sdf1b|TLSF|TLSF-a|TLSF-b|TPAR1 |
| Gene Description | chemokine (C-X-C motif) ligand 12 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is 0.5 mg/mL |
| Gene ID | 20315 |
Más información
Mouse Cxcl12 (P40224, 22 a.a. - 89 a.a.) partial recombinant protein expressed in Escherichia coli.