Ver mas grande
CCL19 (Human) Recombinant Protein
AB-P9545
Producto nuevo
CCL19 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CCL19 |
| Gene Alias | CKb11|ELC|MGC34433|MIP-3b|MIP3B|SCYA19 |
| Gene Description | chemokine (C-C motif) ligand 19 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MASMTGGQQMGRGSHMGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 6363 |
Más información
Human CCL19 (Q99731, 22 a.a. - 98 a.a.) partial recombinant protein with T7 tag at N-terminus expressed in Escherichia coli.