Ver mas grande
Human CCL13 (Q99616, 24 a.a. - 98 a.a.) partial recombinant protein with His tag at N-terminus expressed in iEscherichia coli/i.
AB-P9520
Producto nuevo
CCL13 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 5 ug |
| Gene Name | CCL13 |
| Gene Alias | CKb10|MCP-4|MGC17134|NCC-1|NCC1|SCYA13|SCYL1 |
| Gene Description | chemokine (C-C motif) ligand 13 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (1 mM DTT, 0.1 M NaCl and 10% glycerol) |
| Gene ID | 6357 |
Más información
Human CCL13 (Q99616, 24 a.a. - 98 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.