Ver mas grande
Mouse Ccl7 (Q03366, 24 a.a. - 97 a.a.) partial recombinant protein expressed in iEscherichia coli/i.
AB-P9517
Producto nuevo
Ccl7 (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Ccl7 |
| Gene Alias | MCP-3|Scya7|fic|marc|mcp3 |
| Gene Description | chemokine (C-C motif) ligand 7 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 20306 |
Más información
Mouse Ccl7 (Q03366, 24 a.a. - 97 a.a.) partial recombinant protein expressed in Escherichia coli.