Ver mas grande
Human CCL4L1 (Q8NHW4, 24 a.a. - 92 a.a.) partial recombinant protein with His tag at N-terminus expressed in iEscherichia coli/i
AB-P9498
Producto nuevo
CCL4L1 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CCL4L2 |
| Gene Alias | AT744.2|CCL4L|SCYA4L |
| Gene Description | chemokine (C-C motif) ligand 4-like 2 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 10mM Sodium citrate pH 3.5 (10% glycerol) |
| Gene ID | 388372 |
Más información
Human CCL4L1 (Q8NHW4, 24 a.a. - 92 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.