Ver mas grande
Human CX3CL1 (P78423, 25 a.a. - 100 a.a.) partial recombinant protein expressed in iEscherichia coli/i.
AB-P9452
Producto nuevo
CX3CL1 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CX3CL1 |
| Gene Alias | ABCD-3|C3Xkine|CXC3|CXC3C|NTN|NTT|SCYD1|fractalkine|neurotactin |
| Gene Description | chemokine (C-X3-C motif) ligand 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 6376 |
Más información
Human CX3CL1 (P78423, 25 a.a. - 100 a.a.) partial recombinant protein expressed in Escherichia coli.