Ver mas grande
Ccl21a (Mouse) Recombinant Protein
AB-P9449
Producto nuevo
Ccl21a (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Ccl21a |
| Gene Alias | 6CKBAC2|6Ckine|ALP|AW987545|CKb9|MGC107632|SCYA21a|SLC|Scya21|Scya21b|Tca4|plt |
| Gene Description | chemokine (C-C motif) ligand 21A |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 18829 |
Más información
Mouse Ccl21a (P84444, 24 a.a. - 133 a.a.) partial recombinant protein expressed in Escherichia coli.