CCL27 (Human) Recombinant Protein Ver mas grande

Human CCL27 (Q9Y4X3, 25 a.a. - 112 a.a.) partial recombinant protein expressed in iEscherichia coli/i.

AB-P9428

Producto nuevo

CCL27 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name CCL27
Gene Alias ALP|CTACK|CTAK|ESKINE|ILC|PESKY|SCYA27
Gene Description chemokine (C-C motif) ligand 27
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In 10mM sodium citrate pH 3.5 (10% glycerol)
Gene ID 10850

Más información

Human CCL27 (Q9Y4X3, 25 a.a. - 112 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Human CCL27 (Q9Y4X3, 25 a.a. - 112 a.a.) partial recombinant protein expressed in iEscherichia coli/i.

Human CCL27 (Q9Y4X3, 25 a.a. - 112 a.a.) partial recombinant protein expressed in iEscherichia coli/i.