CXCL14 (Human) Recombinant Protein Ver mas grande

Human CXCL14 (O95715, 35 a.a. - 111 a.a.) partial recombinant protein expressed in iEscherichia coli/i.

AB-P9420

Producto nuevo

CXCL14 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name CXCL14
Gene Alias BMAC|BRAK|KS1|Kec|MGC10687|MIP-2g|NJAC|SCYB14|bolekine
Gene Description chemokine (C-X-C motif) ligand 14
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 9547

Más información

Human CXCL14 (O95715, 35 a.a. - 111 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Human CXCL14 (O95715, 35 a.a. - 111 a.a.) partial recombinant protein expressed in iEscherichia coli/i.

Human CXCL14 (O95715, 35 a.a. - 111 a.a.) partial recombinant protein expressed in iEscherichia coli/i.