Ver mas grande
CDH1 (Human) Recombinant Protein
AB-P9363
Producto nuevo
CDH1 (Human) Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 5 ug |
| Gene Name | CDH1 |
| Gene Alias | Arc-1|CD324|CDHE|ECAD|LCAM|UVO |
| Gene Description | cadherin 1, type 1, E-cadherin (epithelial) |
| Storage Conditions | Lyophilized protein should be stored at -20ºC to -80ºC can stable for 12 months. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | IFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQI |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (100 ug/mL) containing 50 mM Tris-HCl, pH 7.5, 10 mM L-glutathione (reduced). |
| Gene ID | 999 |
Más información
Human CDH1 partial recombinant protein expressed in Escherichia coli.