Ver mas grande
Human NAMPT recombinant protein with His tag in N-terminus expressed in iEscherichia coli/i.
AB-P9331
Producto nuevo
NAMPT (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | NAMPT |
| Gene Alias | 1110035O14Rik|DKFZp666B131|MGC117256|PBEF|PBEF1|VF|VISFATIN |
| Gene Description | nicotinamide phosphoribosyltransferase |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC for long term storage. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKD |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.1 mM DTT. |
| Gene ID | 10135 |
Más información
Human NAMPT recombinant protein with His tag in N-terminus expressed in Escherichia coli.